Growth Hormone Secretagogues
Sermorelin 10mg
10mg
GHRH (1-29) analogue, 10mg vial. Growth hormone secretagogue research peptide.
99.38% purity · Supplier-reported analysis · Batch UKPL-9503 · View certificate
- Same-day dispatch before 2pm, Mon to Fri
- Add £29.01 more for free UK delivery
- Cold-chain shipping. Always. Dry-cold pack, Royal Mail Tracked 24
- Lost, damaged or wrong? Replaced free if you tell us within 48 hours.
- Research use only. For in-vitro laboratory research. Not for use in humans or animals, or in food, drugs or diagnostics. Not evaluated by the MHRA or FDA. The buyer is responsible for handling and regulatory compliance.
Bulk Pricing
Counted across your basket, any mix of products.
| Vials in basket | Discount | Per vial |
|---|---|---|
| 1 | None | £39.99 |
| 3-4 | 5% | £37.99 |
| 5-9 | 8% | £36.79 |
| 10-50 | 12% | £35.19 |
Bacteriostatic Water 10ml
Required to reconstitute lyophilised peptides.
What is Sermorelin 10mg?
Sermorelin 10mg is the larger vial of sermorelin, the 29-residue GHRH (1-29) amide. It holds twice the lyophilised peptide of the 5mg vial in the same single-vial format, under its own batch, UKPL-9503.
Full description
The compound is identical to the 5mg vial: same sequence, same receptor pharmacology, white lyophilised powder. Sermorelin is the shortest fragment of the 44-residue growth-hormone-releasing hormone with full biological activity. Its chemistry and the Geref diagnostic history (Prakash and Goa, BioDrugs, 1999) are covered on the main Sermorelin page.
Sermorelin 10mg Research Applications
The applications match the 5mg vial. Sermorelin is the reference GHRH (1-29) agonist in somatotroph signalling and GHRH receptor pharmacology, and the native comparator when CJC-1295, modified GRF (1-29) or tesamorelin is benchmarked. The 10mg size suits designs that use material quickly, such as dose-response plates, long time-course work and analytical method development. Running a whole design on one batch removes inter-batch variance.
Sermorelin 10mg vs 5mg
The molecule is the same, so the differences are handling and logistics. Each size is its own batch with its own certificate, so the 10mg figures are not inherited from the 5mg batch. At the same fill volume, the 10mg vial gives twice the concentration. One batch under one certificate covers twice the work, and the cost per milligram is lower. The trade-off is exposure. A larger vial is usually drawn from over a longer period, and methionine 27 oxidises with each re-entry. Splitting the stock into single-use aliquots at reconstitution solves that.
Research Overview
This page covers the 10mg presentation. The compound is the same 29-residue peptide amide supplied in the standard vial — GHRH (1-29), sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, molecular weight 3357.9 g/mol, CAS 86168-78-7, the shortest fragment of the native 44-residue growth-hormone-releasing hormone that retains full biological activity — and its pharmacology at the GHRH receptor on anterior pituitary somatotrophs, together with the Geref diagnostic history reviewed by Prakash and Goa (BioDrugs, 1999), is documented in full on the main Sermorelin page. What is specific to the 10mg vial is handling. Ten milligrams is twice the content of the 5mg vial in the same single-vial glass format, so at a fixed fill volume the reconstituted stock is twice as concentrated; fill volume must therefore be scaled to the target concentration rather than carried over from smaller-vial work, and the resulting concentration recorded against the batch. The more consequential point at this size is oxidative exposure across the vial's working life. The sequence carries a methionine at position 27, the oxidation-prone residue that dictates careful handling, and a vial holding twice the mass is typically accessed over a longer period and across more stopper penetrations, which increases cumulative headspace air exposure, light exposure and freeze-thaw opportunity on a single reconstituted stock. Aliquoting into single-use volumes immediately after reconstitution therefore matters more here than on a 5mg vial. The offsetting advantages are batch continuity under one certificate of analysis and a lower cost per milligram, since vial, stopper, lyophilisation and assay costs are incurred per vial rather than per milligram. Each vial contains 10mg of sermorelin as white lyophilised powder, batch UKPL-9503, verified at 99.38% purity by RP-HPLC, with the certificate of analysis published on this page. Supplied strictly for in-vitro laboratory research use only.
Product Specifications
- Molecular Formula
- C₁₄₉H₂₄₆N₄₄O₄₂S
- Molecular Weight
- 3357.9 g/mol
- CAS Number
- 86168-78-7
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (GHRH 1-29 amide)
- Vial Content
- 10mg lyophilised peptide
- Purity
- 99.38% (RP-HPLC, supplier-reported)
- Batch
- UKPL-9503
- Storage
- -20°C lyophilised, 2-8°C reconstituted
- Appearance
- White lyophilised powder
- Form
- Lyophilised powder
Certificate of Analysis
Supplier-reported analysis. Independent third-party verification pending.
- Batch
- UKPL-9503
- Purity
- 99.38%
- Specification
- ≥98.0%
- Method
- RP-HPLC
- Tested
- Sep 2026
Need the certificate for an earlier batch? Request an older CoA
Storage and Reconstitution
Keep sealed vials at -20°C, away from light and moisture. After reconstitution, keep the solution at 2-8°C and use it within 4 weeks, or freeze single-use aliquots at -20°C. On a 10mg vial, aliquoting is the main defence against oxidation of methionine 27. Keep vials tightly sealed with little headspace and away from oxidising agents.
Vials are sold on their own, without bacteriostatic water for mixing or other supplies.
How to reconstitute and handle
Bring the vial and the bacteriostatic water to room temperature and swab both stoppers with alcohol. Add the water slowly down the inside wall, never onto the powder, and swirl gently until dissolved. Do not shake or vortex. The solution should be clear and colourless. Set the fill volume from your target concentration, then split the stock into single-use aliquots straight away. Label each with the date and refrigerate.
- Scale the bacteriostatic water fill volume to your target concentration. A 10mg vial reaches twice the concentration of a 5mg vial at the same fill volume, so a volume carried across from smaller-vial work will not reproduce the same stock.
- Aliquot into single-use volumes immediately after reconstitution and hold them at -20°C. This matters more on a 10mg vial than a 5mg one, because twice the mass in one vial means a longer working life and more accumulated stopper penetrations on a single stock.
- Minimise headspace air exposure and protect from light at every step. The methionine at position 27 is the oxidation-prone residue of the sequence, and a vial with a long in-use window accumulates more oxidative exposure than a small one.
- Do not leave dilute solution standing at room temperature. Return aliquots to cold storage promptly after each withdrawal rather than working from a stock left out across a session.
- Introduce the diluent slowly down the inner glass wall, never onto the lyophilised cake, and swirl gently until fully dissolved. Allow the vial to reach room temperature before opening.
For the full method, see the peptide reconstitution guide and the reconstitution calculator.
Research References
- Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency (Prakash and Goa, BioDrugs, 1999)
- Sermorelin: a better approach to management of adult-onset growth hormone insufficiency? (Walker, Clin Interv Aging, 2006)
Published research on Sermorelin is indexed on PubMed. See our full UK buyer's guide for Sermorelin and UK buyer's guide for Sermorelin 10mg.
Sermorelin 10mg Price (UK)
Sermorelin 10mg is for sale in 2 vial sizes, priced from £27.99 for 5mg to £39.99 for 10mg. Every size ships from our UK facility, each with its own batch certificate. UK delivery is £4.50 by Royal Mail Tracked 24, free over £69.
| Vial | Price | Cost per mg | Availability |
|---|---|---|---|
| Sermorelin 5mg | £27.99 | £5.60 | Out of stock |
| Sermorelin 10mgThis page | £39.99 | £4.00Best value | In stock |
Prices are in GBP per vial and match the basket. See the FAQ for delivery and payment options, and quality & testing for how each batch is checked.
Frequently Asked Questions
What is in a Sermorelin 10mg vial?
A Sermorelin 10mg vial contains 10 milligrams of the 29-residue peptide amide as a white lyophilised powder, twice the content of the 5mg vial. Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, molecular weight 3357.9 g/mol, CAS 86168-78-7. Batch UKPL-9503 is verified at 99.38% purity by RP-HPLC with a quantity assay confirming the 10mg content, and the certificate of analysis is published on this page.
How does the Sermorelin 10mg vial differ from the 5mg vial?
Only in the mass of peptide per vial. It is the same compound, the same sequence and the same lyophilised powder, at twice the content. The practical differences are that a 10mg vial reaches twice the concentration at a given reconstitution volume, that all 10mg shares one in-use window and one reconstitution date once opened, and that a single batch and certificate of analysis covers twice as much work. Each size carries its own batch and its own published certificate.
Why does a 10mg vial need aliquoting more than a 5mg vial?
Because the oxidation-prone residue in the sequence is exposed for longer. Sermorelin carries a methionine at position 27, which oxidises in dilute solution in proportion to air exposure, light and time at room temperature. A vial holding twice the mass is usually consumed over a longer period and across more stopper penetrations, so a single reconstituted stock accumulates more oxidative history. Drawing single-use aliquots at the point of reconstitution isolates each withdrawal from that history.
How much bacteriostatic water does a Sermorelin 10mg vial need?
That depends entirely on the concentration your protocol specifies, so there is no fixed figure and we do not provide dosing information. The arithmetic is mass divided by volume: 10mg reconstituted with 2mL gives a 5mg/mL stock, and the same 10mg in 1mL gives 10mg/mL. Because a 10mg vial reaches twice the concentration of a 5mg vial at identical fill volume, volumes should not be carried over unchanged between the two sizes.
Is the 10mg vial the same compound as the 5mg vial?
Yes. Both vials contain the identical 29-residue peptide, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, at 3357.9 g/mol, and neither is a modified analogue or a different sequence. The 10mg vial is not a stronger material, it simply holds more of it. Each vial size carries its own batch number and its own published certificate of analysis, so the purity figure quoted for the 10mg vial applies to that batch specifically rather than being inherited from the 5mg batch.
What purity is your Sermorelin 10mg and is it supplier-tested?
The current Sermorelin 10mg batch is UKPL-9503, verified at 99.38% purity by HPLC, and the supplier certificate of analysis is published on this product page rather than provided on request. Check that the batch number on the vial matches the certificate, and that the report carries a quantity assay confirming 10mg of content, since purity alone says nothing about how much peptide is actually in the vial.
Where can I buy Sermorelin 10mg in the UK?
UK Peptide Lab supplies Sermorelin 10mg in the UK, batch UKPL-9503 at 99.38% purity, supplier-tested, with the certificate of analysis published on this page and independent third-party verification in progress, and dispatched the same day on orders placed before 2pm UK time. Free UK Royal Mail Tracked shipping on orders over £69. The 5mg vial of the same compound is also stocked. Purchasers must be 18 or over and confirm research-only use. Not for human consumption or any therapeutic application.
What is the difference between the 5mg and 10mg vials?
Only the mass of peptide per vial. Both hold the same 29-residue GHRH (1-29) amide at 3357.9 g/mol. Each size has its own batch and published certificate, so the 10mg batch, UKPL-9503, does not borrow the 5mg batch's figures. At a given fill volume, the 10mg vial gives twice the concentration.
Is your Sermorelin supplier-tested, with independent verification in progress?
Yes. The certificate for batch UKPL-9503 is a supplier-reported analysis: 99.38% purity by RP-HPLC and 10.11mg measured content. Independent third-party verification is pending. The certificate is published on the product page, and its batch number matches the vial.
Related Products
