Sermorelin 10mg
10mg
Sermorelin is a synthetic 29 amino acid peptide corresponding to the biologically active 1-29 fragment of growth hormone-releasing hormone (GHRH), the shortest fully functional GHRH sequence. Research has examined its role as a growth hormone secretagogue acting at the pituitary GHRH receptor to stimulate endogenous, pulsatile growth hormone release, and it is widely used as a reference GHRH analogue in neuroendocrine and somatotroph signalling studies. This 10mg presentation is the higher-mass research format, supplied in the same single lyophilised vial as the 5mg. Supplier-tested, with the certificate published on this page and independent third-party verification pending.
Published research on Sermorelin is indexed on PubMed.
Intended Use: Strictly for in-vitro laboratory research. Not for use in humans or animals. Not to be used in foods, drugs, or medical diagnostics. This product has not been evaluated by the MHRA or FDA. Buyer assumes full responsibility for safe handling and regulatory compliance.
99.38%
Purity
LAB
Certified
SAME
Day Ship
Quantity
Add £5.01 more for free UK delivery
Damaged or lost? Free reshipment guaranteed
Bacteriostatic Water 10ml
Required to reconstitute lyophilised peptides.
Research Use Only
This product is intended strictly for research and laboratory use only. Not for human consumption, medical use, or diagnostic purposes.
Certificate of Analysis
Third-party tested
Lyophilised Stability
24 months
Sealed at -20°C, light-protected
Reconstituted Stability
Up to 3 months
Stored at 2-8°C after mixing
Cold-Chain Shipping
Always
Dry-cold pack, Royal Mail Tracked 24
Important Notice
All compounds are sold individually and do not include research supplies. Products are provided in lyophilised (powder) form and require proper reconstitution before use in research settings.
Related Products
Sermorelin 10mg Price (UK)
Sermorelin 10mg is supplied in 2 vial sizes, priced from £24.99 for 5mg to £39.99 for 10mg. Every size ships from our UK facility with the same third-party HPLC certificate published on this page. UK delivery is £4.50 by Royal Mail Tracked 24, or free once your basket reaches £45 (£5.01 away at this price). Orders placed before 2pm on a working day are dispatched the same day.
| Vial | Price | Cost per mg | Availability |
|---|---|---|---|
| Sermorelin 10mg 5mg | £24.99 | £5.00 | In stock |
| Sermorelin 10mg 10mgThis page | £39.99 | £4.00Best value | In stock |
Prices are in GBP and shown per vial as supplied, lyophilised, for in-vitro laboratory research only. Cost per mg is given so researchers can compare vial sizes on a like-for-like basis. Stock and pricing on this table are read live from our inventory, so they match the basket. See our FAQ for delivery and payment options, and quality & testing for how each batch is verified.
Product Specifications
Research Overview
This page covers the 10mg presentation. The compound is the same 29-residue peptide amide supplied in the standard vial — GHRH (1-29), sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, molecular weight 3357.9 g/mol, CAS 86168-78-7, the shortest fragment of the native 44-residue growth-hormone-releasing hormone that retains full biological activity — and its pharmacology at the GHRH receptor on anterior pituitary somatotrophs, together with the Geref diagnostic history reviewed by Prakash and Goa (BioDrugs, 1999), is documented in full on the main Sermorelin page. What is specific to the 10mg vial is handling. Ten milligrams is twice the content of the 5mg vial in the same single-vial glass format, so at a fixed fill volume the reconstituted stock is twice as concentrated; fill volume must therefore be scaled to the target concentration rather than carried over from smaller-vial work, and the resulting concentration recorded against the batch. The more consequential point at this size is oxidative exposure across the vial's working life. The sequence carries a methionine at position 27, the oxidation-prone residue that dictates careful handling, and a vial holding twice the mass is typically accessed over a longer period and across more stopper penetrations, which increases cumulative headspace air exposure, light exposure and freeze-thaw opportunity on a single reconstituted stock. Aliquoting into single-use volumes immediately after reconstitution therefore matters more here than on a 5mg vial. The offsetting advantages are batch continuity under one certificate of analysis and a lower cost per milligram, since vial, stopper, lyophilisation and assay costs are incurred per vial rather than per milligram. Each vial contains 10mg of sermorelin as white lyophilised powder, batch UKPL-9503, verified at 99.38% purity by RP-HPLC, with the certificate of analysis published on this page. Supplied strictly for in-vitro laboratory research use only.
Product Specifications
Laboratory Handling
- Scale the bacteriostatic water fill volume to your target concentration. A 10mg vial reaches twice the concentration of a 5mg vial at the same fill volume, so a volume carried across from smaller-vial work will not reproduce the same stock.
- Aliquot into single-use volumes immediately after reconstitution and hold them at -20°C. This matters more on a 10mg vial than a 5mg one, because twice the mass in one vial means a longer working life and more accumulated stopper penetrations on a single stock.
- Minimise headspace air exposure and protect from light at every step. The methionine at position 27 is the oxidation-prone residue of the sequence, and a vial with a long in-use window accumulates more oxidative exposure than a small one.
- Do not leave dilute solution standing at room temperature. Return aliquots to cold storage promptly after each withdrawal rather than working from a stock left out across a session.
- Introduce the diluent slowly down the inner glass wall, never onto the lyophilised cake, and swirl gently until fully dissolved. Never shake or vortex — mechanical shear reduces recovery of intact 29-residue peptide. Allow the vial to reach room temperature before opening.
Frequently Asked Questions
What is Sermorelin 10mg?
The 10mg vial is the higher-mass presentation of sermorelin, the synthetic 29-residue peptide amide corresponding to the first 29 amino acids of human growth-hormone-releasing hormone, sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, molecular weight 3357.9 g/mol, CAS 86168-78-7. The compound is identical to the one in the 5mg vial — same sequence, same receptor pharmacology — and the full chemistry, the GHRH (1-29) identity as the shortest fragment of the native 44-residue hormone that retains full biological activity, and the Geref diagnostic history reviewed by Prakash and Goa (BioDrugs, 1999) are documented on the main Sermorelin page and are not repeated here. This page documents what is specific to the 10mg format: double the lyophilised mass in the same single-vial glass format, which means twice the concentration at a given fill volume, one batch and one certificate of analysis covering twice as much work, and a longer in-use window on a sequence whose methionine at position 27 is oxidation-prone. Supplied as lyophilised powder for in-vitro research use only, not a licensed medicine anywhere.
Sermorelin 10mg vs 5mg
The two vials contain the same molecule, so this is a handling and logistics comparison rather than a chemical one, and there is deliberately no purity or quality difference between the sizes — each vial size is its own batch, with its own certificate of analysis, and the 10mg batch UKPL-9503 carries its own published certificate rather than inheriting the 5mg batch's figures. The 10mg vial is the higher-mass format for protocols that call for a larger total peptide mass: 10mg lyophilised in the same single-vial glass format as the 5mg. At an identical fill volume the reconstituted stock reaches twice the concentration, so fill volumes must be scaled rather than carried over from smaller-vial work. The trade-offs run in both directions. In the 10mg vial's favour: batch continuity, since one batch under one certificate covers double the work, and a lower cost per milligram, since vial, stopper, lyophilisation and third-party assay costs are incurred per vial rather than per milligram. Against it: exposure. A vial holding twice the mass is typically accessed over a longer period and across more stopper penetrations, and sermorelin's methionine at position 27 is the oxidation-prone residue of the sequence, so a single reconstituted stock accumulates more oxidative history. Aliquoting into single-use volumes at the point of reconstitution is what reconciles the two.
Sermorelin 10mg Research Applications
The applications are those documented for the 5mg vial, since the compound is the same: work as the reference GHRH (1-29) receptor agonist in somatotroph signalling and pituitary growth hormone release models, GHRH receptor pharmacology, and comparative studies in which stabilised analogues — modified GRF (1-29), CJC-1295, tesamorelin — are benchmarked against the native fragment they all derive from. Vial content affects study logistics rather than endpoint selection. Dose-response matrices across many wells or plates, extended time-course work and analytical method development all consume material faster than a 5mg vial supports comfortably, and running the whole design against one 10mg batch removes inter-batch variance from the analysis while one certificate of analysis covers the entire dataset. The honest boundaries are unchanged from the 5mg page: the human literature is the Geref diagnostic era reviewed by Prakash and Goa (BioDrugs, 1999), the Walker (Clin Interv Aging, 2006) paper is a perspective article rather than a trial report, and material supplied here is for in-vitro laboratory research only.
Reconstitution Guide
Allow the vial and the bacteriostatic water to reach room temperature, then sterilise the rubber stopper of both vials with an alcohol swab. Draw your diluent into a sterile syringe and inject it slowly down the inner glass wall, never directly onto the lyophilised cake, then swirl gently in a slow circular motion until fully dissolved. Never shake or vortex — a 29-residue peptide is shear-sensitive and agitation reduces recovery of intact material. The solution should be clear and colourless. Two points are specific to the 10mg vial. First, set the fill volume from your target concentration, since 10mg reaches twice the concentration of 5mg at identical volume: 10mg in 2mL gives a 5mg/mL stock, and the same 10mg in 1mL gives 10mg/mL. We specify no fill volume, as that is a protocol decision, and provide no dosing information. Second, aliquot into single-use volumes at the point of reconstitution rather than later, because the methionine at position 27 is oxidation-prone and a larger vial accessed over a longer working life accumulates more headspace air exposure while the peptide sits in dilute solution. Label the vial with the reconstitution date and refrigerate immediately.
See our full peptide reconstitution guide and reconstitution calculator for step-by-step protocol.
Storage Instructions
Lyophilised vials should be stored at -20°C, protected from light and moisture, and remain stable for up to 24 months. Once reconstituted with bacteriostatic water, store the solution at 2-8°C (standard refrigerator) and use within approximately 4 weeks. For longer storage, prepare single-use aliquots at -20°C and avoid repeated freeze-thaw cycles. On a 10mg vial, aliquoting is not optional good practice but the main defence of the material, because the degradation route to design against with sermorelin is oxidation of the methionine at position 27, and a stock holding twice the mass of the standard vial is typically drawn from over a longer working life, accumulating oxidative exposure with every re-entry. Keep vials tightly sealed with minimal headspace, protect from light, never store the solution in contact with oxidising agents, and label every aliquot with the reconstitution date. Handle under sterile laboratory conditions throughout.
Frequently Asked Questions
Research References
Related Research Compounds
Sermorelin 10mg
10mg · £39.99